Skip to content
swegene

SWEGENE, The Postgenomic Research and Technology Programme in South Western Sweden

Genomics

  • Home
  • Culture Cells
  • Elisa Kits
  • Antibodies
  • Genetic analysis tools
  • Contact Us

Informed Consent for Genetic and Genomic Research

Informed Consent for Genetic and Genomic Research
November 19, 2020By Tyrone Brown
  • Antibodies
  • Assay Kits
  • Biology Cells
  • cDNA
  • Culture Cells
  • Default
  • Devices
  • DNA
  • DNA Templates
  • DNA Testing
  • Elisa Kits
  • Equipments
  • Exosomes
  • Gels
  • PCR
  • Pcr Kits
  • Peptides
  • Reagents
  • Recombinant Proteins
  • Ria Kits
  • RNA
  • Test Kits
  • Vector & Virus
  • Western Blot

Genetic analysis usually makes use of or generates data that’s doubtlessly delicate to people, households, or communities. For these causes, genetic analysis might warrant further scrutiny from investigators and governmental regulators, in comparison with different forms of biomedical analysis.

The knowledgeable consent course of ought to tackle the vary of social and psychological points that will come up in genetic analysis. This text addresses quite a few these points, together with recruitment of contributors, disclosure of outcomes, psychological influence of outcomes, insurance coverage and employment discrimination, neighborhood engagement, consent for tissue banking, and mental property points. Factors of consideration are supplied to help within the improvement of protocols and consent processes in gentle of latest debates on quite a few these points. © 2020 Wiley Periodicals LLC.

Genomic Profiling of Multifocal Intrahepatic Cholangiocarcinoma Reveals Intraindividual Concordance of Genetic Alterations

In multifocal intrahepatic cholangiocarcinoma (IHC), intrahepatic metastases (IM) signify a contraindication to surgical resection, whereas satellite tv for pc nodules (SN) don’t. Nevertheless, no consensus standards exist to differentiate IM from SN. The aim of this examine was to find out genetic alterations and clonal relationships in surgically resected multifocal IHC. Subsequent-generation sequencing of 34 spatially separated IHC tumors was carried out utilizing a focused panel of 201 cancer-associated genes.
Proposed definitions within the literature have been utilized of SN situated in the identical liver phase and ≤ 2 cm from the first tumor; and IM situated in a distinct liver phase and/or > 2 cm from the first tumor. Somatic level mutations concordant throughout tumors from particular person sufferers included BAP1, SMARCA4, and IDH1. Small insertions and deletions (indels) current on the similar genome positions amongst all tumors from people included indels in DNA restore genes, CHEK1, ERCC5, ATR, and MSH6.
Copy quantity alterations have been additionally related between all tumors in every affected person. On this cohort of multifocal IHC, genomic profiles have been concordant throughout all tumors in every affected person, suggesting a typical progenitor cell origin, whatever the location of tumors within the liver. The choice to carry out surgical procedure shouldn’t be based mostly upon a perceived distinction between IM and SN.

Classes of the month: A breathless extreme asthmatic within the genomic period: Occam’s razor or Hickam’s dictum?

Breathlessness is a subjective symptom that will stem from quite a few pathological and purposeful aetiologies. Consequently, clinicians are sometimes confronted with the problem of navigating between the tensions of Occam’s razor (parsimonious aetiology) or Hickam’s dictum (a number of diagnoses).
We report a case of a 36-year-old lady with a lifelong historical past of episodic breathlessness prompted at varied instances by dysfunctions of lung parenchyma (emphysema) and airway clean muscle (bronchial asthma), skeletal muscle (filamin-C fibrillary myopathy) and cardiac muscle (cardiomyopathy).
We illustrate the utility of the trendy diagnostic toolbox within the evaluation, understanding and administration of advanced dyspnoea (together with using inflammometry, inhaled-gas magnetic resonance imaging-guided bronchial thermoplasty, and genetic testing), and in addition exhibit the significance of interdisciplinary knowledge interpretation in establishing correct aetiologic diagnoses.

Mind-specific monoallelic expression of bovine UBE3A is related to genomic place

Genomic imprinting is a uncommon epigenetic course of in mammalian cells that results in monoallelic expression of a gene with a parent-specific sample. The UBE3A (ubiquitin protein ligase E3A) gene is imprinted with maternal allelic expression within the mind however biallelically expressed in all different tissues in people. The silencing of the paternal UBE3A allele is considered brought on by the paternally expressed antisense RNA transcript of UBE3A-ATS. The aberrant imprinted expression of the UBE3A is related to a number of neurodevelopmental syndromes and psychological issues.
Cattle are a priceless mannequin species in figuring out the genetic etiology of sporadic human dysfunction, and maternal expression of UEB3A has been revealed by next-generation sequencing examine within the bovine conceptus. On this examine, we investigated the allelic expression of UBE3A and UBE3A-ATS in grownup bovine somatic tissues.
Comparative Genomics Reveals Novel Target Genes towards Specific Control of Plant-Parasitic Nematodes
To verify the splicing sample of bovine UBE3A, 5 5′ different transcripts (MT210534-MT210538) have been first obtained from bovine mind tissue by RT-PCR. Primarily based on 10 SNP genotypes, we discovered that the brain-specific monoallelic expression of bovine UBE3A didn’t happen alongside your entire locus, and there was a shift from biallelic expression to monoallelic expression in exon 14 of the UBE3A gene. Nevertheless, the brain-specific monoallelic expression of bovine UBE3A-ATS occurred in your entire gene. These observations demonstrated that the monoallelic expression didn’t happen alongside the bovine UBE3A complete locus and was related to the genomic place.

The Range of Primates: From Biomedicine to Conservation Genomics

Till now, the sector of primate genomics has targeted on two main themes: understanding human evolution and advancing biomedical analysis. We suggest that it’s now time for a 3rd theme to obtain consideration: conservation genomics. Because of anthropogenic results, nearly all of primate species have turn out to be threatened with extinction. A extra sturdy primate conservation genomics will enable for genetically knowledgeable inhabitants administration. Due to a gradual decline in the price of sequencing, it has now turn out to be possible to sequence complete primate genomes on the inhabitants stage.

Recombinant Aspergillus Terreus AIM24 Protein (aa 12-374) [His]

VAng-Wyb4034-1mg Creative Biolabs 1 mg
EUR 4655
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Aim24p, recombinant protein.

Recombinant Aspergillus Terreus ATG5 Protein (aa 1-315) [His]

VAng-Wyb4035-1mg Creative Biolabs 1 mg
EUR 4466
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Autophagy Related 5 Homolog, recombinant protein.

Recombinant Aspergillus Terreus Bna1 Protein (aa 1-195) [His]

VAng-Wyb4036-1mg Creative Biolabs 1 mg
EUR 3991
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) 3-Hydroxyanthranilate 3,4-Dioxygenase, recombinant protein.

Recombinant Aspergillus Terreus Bna4 Protein (aa 1-500) [His]

VAng-Wyb4037-1mg Creative Biolabs 1 mg
EUR 5194
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) 3-Kynurenine 3-Monooxygenase, recombinant protein.

Recombinant Aspergillus Terreus CBP4 Protein (aa 1-116) [His]

VAng-Wyb4038-1mg Creative Biolabs 1 mg
EUR 3677
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Cbp4p, recombinant protein.

Recombinant Aspergillus Terreus CFD1 Protein (aa 1-311) [His]

VAng-Wyb4039-1mg Creative Biolabs 1 mg
EUR 4447
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Cfd1p, recombinant protein.

Recombinant Aspergillus Terreus CHZ1 Protein (aa 1-111) [His]

VAng-Wyb4040-1mg Creative Biolabs 1 mg
EUR 3657
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Chz1p, recombinant protein.

Recombinant Aspergillus Terreus CSM3 Protein (aa 1-302) [His]

VAng-Wyb4042-1mg Creative Biolabs 1 mg
EUR 4413
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Csm3p, recombinant protein.

Recombinant Aspergillus Terreus DDI1 Protein (aa 1-413) [His]

VAng-Wyb4043-1mg Creative Biolabs 1 mg
EUR 4848
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) DNA-Damage Inducible 1 Homolog 1, recombinant protein.

Recombinant Aspergillus Terreus DRE2 Protein (aa 1-307) [His]

VAng-Wyb4044-1mg Creative Biolabs 1 mg
EUR 4433
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Dre2p, recombinant protein.

Recombinant Aspergillus Terreus EFG1 Protein (aa 1-311) [His]

VAng-Wyb4045-1mg Creative Biolabs 1 mg
EUR 4447
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Efg1p, recombinant protein.

Recombinant Aspergillus Terreus Egd2 Protein (aa 1-202) [His]

VAng-Wyb4046-1mg Creative Biolabs 1 mg
EUR 4017
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Nascent Polypeptide-Associated Complex Subunit alpha, recombinant protein.

Recombinant Aspergillus Terreus EIF3E Protein (aa 1-446) [His]

VAng-Wyb4047-1mg Creative Biolabs 1 mg
EUR 4983
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Eukaryotic Translation Initiation Factor 3 Subunit E, recombinant protein.

Recombinant Aspergillus Terreus EIF3G Protein (aa 1-286) [His]

VAng-Wyb4048-1mg Creative Biolabs 1 mg
EUR 4350
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Eukaryotic Translation Initiation Factor 3, Subunit G, recombinant protein.

Recombinant Aspergillus Terreus EIF3I Protein (aa 1-336) [His]

VAng-Wyb4049-1mg Creative Biolabs 1 mg
EUR 4545
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Eukaryotic Translation Initiation Factor 3, Subunit I, recombinant protein.

Recombinant Aspergillus Terreus FEN1 Protein (aa 1-395) [His]

VAng-Wyb4050-1mg Creative Biolabs 1 mg
EUR 4777
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Flap Structure-Specific Endonuclease 1, recombinant protein.

Recombinant Aspergillus Terreus FES1 Protein (aa 1-212) [His]

VAng-Wyb4051-1mg Creative Biolabs 1 mg
EUR 4056
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Fes1p, recombinant protein.

Recombinant Aspergillus Terreus FYV10 Protein (aa 1-406) [His]

VAng-Wyb4052-1mg Creative Biolabs 1 mg
EUR 4826
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Fyv10p, recombinant protein.

Recombinant Aspergillus Terreus H2A Protein (aa 2-131) [His]

VAng-Wyb4053-1mg Creative Biolabs 1 mg
EUR 3734
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Histone H2A, recombinant protein.

Recombinant Aspergillus Terreus HCR1 Protein (aa 1-266) [His]

VAng-Wyb4054-1mg Creative Biolabs 1 mg
EUR 4270
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Hcr1p, recombinant protein.

Recombinant Aspergillus Terreus JIP5 Protein (aa 1-420) [His]

VAng-Wyb4055-1mg Creative Biolabs 1 mg
EUR 4879
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Jip5p, recombinant protein.

Recombinant Aspergillus Terreus KAE1 Protein (aa 1-361) [His]

VAng-Wyb4056-1mg Creative Biolabs 1 mg
EUR 4645
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Kae1p, recombinant protein.

Recombinant Aspergillus Terreus LCL2 Protein (aa 21-119) [His]

VAng-Wyb4057-1mg Creative Biolabs 1 mg
EUR 3610
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Lcl2p, recombinant protein.

Recombinant Aspergillus Terreus LOC1 Protein (aa 1-188) [His]

VAng-Wyb4058-1mg Creative Biolabs 1 mg
EUR 3962
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Loc1p, recombinant protein.

Recombinant Aspergillus Terreus LOC100799412 Protein (aa 1-370) [His]

VAng-Wyb4059-1mg Creative Biolabs 1 mg
EUR 4683
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Mitogen-Activated Protein Kinase MpkC, recombinant protein.

Recombinant Aspergillus Terreus MDE1 Protein (aa 1-241) [His]

VAng-Wyb4060-1mg Creative Biolabs 1 mg
EUR 4172
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Mde1p, recombinant protein.

Recombinant Aspergillus Terreus MED10 Protein (aa 1-155) [His]

VAng-Wyb4061-1mg Creative Biolabs 1 mg
EUR 3828
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Mediator Complex Subunit 10, recombinant protein.

Recombinant Aspergillus Terreus MED6 Protein (aa 1-324) [His]

VAng-Wyb4062-1mg Creative Biolabs 1 mg
EUR 4498
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Mediator Complex Subunit 6, recombinant protein.

Recombinant Aspergillus Terreus MED7 Protein (aa 1-259) [His]

VAng-Wyb4063-1mg Creative Biolabs 1 mg
EUR 4243
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Mediator Complex Subunit 7, recombinant protein.

Recombinant Aspergillus Terreus METTL1 Protein (aa 1-346) [His]

VAng-Wyb4064-1mg Creative Biolabs 1 mg
EUR 4587
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Methyltransferase Like 1, Subunit G, recombinant protein.

Recombinant Aspergillus Terreus MMM1 Protein (aa 42-486) [His]

VAng-Wyb4065-1mg Creative Biolabs 1 mg
EUR 4977
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Mmm1p, recombinant protein.

Recombinant Aspergillus Terreus Mri1 Protein (aa 1-377) [His]

VAng-Wyb4066-1mg Creative Biolabs 1 mg
EUR 4708
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Methylthioribose-1-Phosphate Isomerase Homolog, recombinant protein.

Recombinant Aspergillus Terreus NBP35 Protein (aa 1-348) [His]

VAng-Wyb4067-1mg Creative Biolabs 1 mg
EUR 4592
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Nbp35p, recombinant protein.

Recombinant Aspergillus Terreus PXR1 Protein (aa 1-298) [His]

VAng-Wyb4068-1mg Creative Biolabs 1 mg
EUR 4397
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Pxr1p, recombinant protein.

Recombinant Aspergillus Terreus RPS1 Protein (aa 2-256) [His]

VAng-Wyb4069-1mg Creative Biolabs 1 mg
EUR 4227
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Rps1 Gene Product, recombinant protein.

Recombinant Aspergillus Terreus RRP36 Protein (aa 1-356) [His]

VAng-Wyb4070-1mg Creative Biolabs 1 mg
EUR 4625
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Rrp36p, recombinant protein.

Recombinant Aspergillus Terreus RTT106 Protein (aa 1-468) [His]

VAng-Wyb4071-1mg Creative Biolabs 1 mg
EUR 5068
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Rtt106p, recombinant protein.

Recombinant Aspergillus Terreus SFH5 Protein (aa 1-424) [His]

VAng-Wyb4072-1mg Creative Biolabs 1 mg
EUR 4897
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Sfh5p, recombinant protein.

Recombinant Aspergillus Terreus Slx1 Protein (aa 1-390) [His]

VAng-Wyb4073-1mg Creative Biolabs 1 mg
EUR 4760
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Structure-Specific Endonuclease Subunit Slx1, recombinant protein.

Recombinant Aspergillus Terreus SSN8 Protein (aa 1-301) [His]

VAng-Wyb4074-1mg Creative Biolabs 1 mg
EUR 4408
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Ssn8p, recombinant protein.

Recombinant Aspergillus Terreus STS1 Protein (aa 1-314) [His]

VAng-Wyb4075-1mg Creative Biolabs 1 mg
EUR 4460
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Sts1p, recombinant protein.

Recombinant Aspergillus Terreus XLNB Protein (aa 38-225) [His]

VAng-Wyb4076-1mg Creative Biolabs 1 mg
EUR 3962
Description: Aspergillus Terreus XlnB Gene Product, recombinant protein.

Recombinant Aspergillus Terreus YAE1 Protein (aa 1-220) [His]

VAng-Wyb4077-1mg Creative Biolabs 1 mg
EUR 4089
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) Yae1p, recombinant protein.

Recombinant Aspergillus Terreus COQ-4 Protein (aa 41-287) [His]

VAng-Wyb4041-1mg Creative Biolabs 1 mg
EUR 4193
Description: Aspergillus Terreus (strain NIH 2624 / FGSC A1156) COenzyme Q (Ubiquinone) Biosynthesis Family Member (Coq-4), recombinant protein.

Aspergillus Antibody

abx022920-1ml Abbexa 1 ml
EUR 648

Aspergillus flavus Exochitosanase

1-CSB-EP306651AVD Cusabio
  • EUR 505.00
  • EUR 265.00
  • EUR 1827.00
  • EUR 766.00
  • EUR 1218.00
  • EUR 335.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus flavus Exochitosanase,partial expressed in E.coli

Aspergillus fumigatus Protein

abx069754-1mg Abbexa 1 mg
EUR 1539

Aspergillus Antibody (FITC)

abx411129-1ml Abbexa 1 ml
EUR 509

Aspergillus Antigen Protein

abx169703-100mg Abbexa 100 mg
EUR 537

Andrastin A, Aspergillus fumigatus

2149-1000 Biovision
EUR 588

Andrastin A, Aspergillus fumigatus

2149-250 Biovision
EUR 229

Asp f 3, Aspergillus

LF-P0503 Abfrontier 0.1 mg
EUR 350
Description: Asp f 3, Aspergillus protein

Asp f 3, Aspergillus

LF-P0503A Abfrontier 0.5 mg
EUR 1247
Description: Asp f 3, Aspergillus protein

Asp f 3, Aspergillus

LF-P0503B Abfrontier 1 mg
EUR 1998
Description: Asp f 3, Aspergillus protein

Native Aspergillus sp. Catalase

DIA-131 Creative Enzymes 100 KU
EUR 270

Aspergillus fumigatus PCR kit

PCR-VH002-48D Bioingentech 50T
EUR 453

Aspergillus fumigatus PCR kit

PCR-VH002-96D Bioingentech 100T
EUR 572

Native Aspergillus niger Pectinase

NATE-0535 Creative Enzymes 250 mg
EUR 270

Cellulase from Aspergillus niger

abx082085-1g Abbexa 1 g
EUR 189

Cellulase from Aspergillus niger

20-abx082478 Abbexa
  • EUR 773.00
  • EUR 356.00
  • 100 g
  • 25 g

Inactivated Aspergillus Fumigatus Antigen

VAng-Wyb3743-1mg Creative Biolabs 1 mg
EUR 5657
Description: Aspergillus Fumigatus, natural antigen.

Human Aspergillus galactomannan ELISA kit

E01A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Aspergillus galactomannan ELISA kit

E01A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Human Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Aspergillus galactomannan ELISA kit

E02A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rat Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Aspergillus galactomannan ELISA kit

E02A0108-48 BlueGene 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rat Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Aspergillus galactomannan ELISA kit

E02A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rat Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Aspergillus galactomannan ELISA kit

E04A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rabbit Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Aspergillus galactomannan ELISA kit

E04A0108-48 BlueGene 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rabbit Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Aspergillus galactomannan ELISA kit

E04A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rabbit Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Aspergillus galactomannan ELISA kit

E03A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Aspergillus galactomannan ELISA kit

E03A0108-48 BlueGene 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Aspergillus galactomannan ELISA kit

E03A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Aspergillus fumigatus IgA ELISA kit

55R-IB79204 Fitzgerald 96 wells
EUR 316
Description: ELISA kit for the detection of Aspergillus fumigatus IgA in the research laboratory

Aspergillus fumigatus IgG ELISA Kit

55R-RE56111 Fitzgerald 96 wells
EUR 330
Description: ELISA kit for detection of Aspergillus fumigatus IgG in the research laboratory

Aspergillus fumigatus IgM ELISA Kit

55R-RE56121 Fitzgerald 96 wells
EUR 316
Description: ELISA kit for detection of Aspergillus fumigatus IgM in the research laboratory

Aspergillus restrictus Ribonuclease mitogillin (ret)

1-CSB-EP303691APQ Cusabio
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus restrictus Ribonuclease mitogillin(ret) expressed in E.coli

Aspergillus niger Glucose oxidase (gox)

1-CSB-EP319481DOZ Cusabio
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus niger Glucose oxidase(gox),partial expressed in E.coli

Aspergillus niger Aspergillopepsin-2,

1-CSB-EP338616DOZ Cusabio
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus niger Aspergillopepsin-2,partial expressed in E.coli

Pig Aspergillus galactomannan ELISA kit

E07A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Porcine Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Aspergillus galactomannan ELISA kit

E07A0108-48 BlueGene 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Porcine Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Aspergillus galactomannan ELISA kit

E07A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Porcine Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Aspergillus galactomannan ELISA kit

E09A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Monkey Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Aspergillus galactomannan ELISA kit

E09A0108-48 BlueGene 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Monkey Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Aspergillus galactomannan ELISA kit

E09A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Monkey Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Aspergillus galactomannan ELISA kit

E06A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Goat Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Aspergillus galactomannan ELISA kit

E06A0108-48 BlueGene 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Goat Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Aspergillus galactomannan ELISA kit

E06A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Goat Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Aspergillus galactomannan ELISA kit

E08A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Canine Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Aspergillus galactomannan ELISA kit

E08A0108-48 BlueGene 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Canine Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Aspergillus galactomannan ELISA kit

E08A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Canine Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Aspergillus niger Glucose oxidase (gox)

1-CSB-BP319481DOZ Cusabio
  • EUR 840.00
  • EUR 332.00
  • EUR 2170.00
  • EUR 1135.00
  • EUR 1579.00
  • EUR 470.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus niger Glucose oxidase(gox),partial expressed in Baculovirus

Aspergillus Fumigatus IgM ELISA Kit

DEIA314 Creative Diagnostics 96T
EUR 611
Description: The Aspergillus fumigatus IgM Antibody ELISA Test Kit has beendesigned for the detection and the quantitative determination of specificIgM antibodies against Aspergillus fumigatus in serum and plasma.

Native Aspergillus sp. Glucose Oxidase

DIA-193 Creative Enzymes 100KU
EUR 270

Native Aspergillus niger Glucose Oxidase

NATE-0311 Creative Enzymes 1MU
EUR 594

Mouse Anti Aspergillus Monoclonal Antibody

DMABT-51085MA Creative Diagnostics 0.2 mg
EUR 741

Rabbit Anti-Aspergillus Polyclonal Antibody

DPAB0232 Creative Diagnostics 1 ml
EUR 781

Rabbit Anti Aspergillus Polyclonal Antibody

DPBT-66808RA Creative Diagnostics 1 ml
EUR 767

Aspergillus spp. (A. spp.) Antibody

abx414358-025mg Abbexa 0.25 mg
EUR 648

Aspergillus fumigatus RT PCR kit

RTq-VH002-100D Bioingentech 100T
EUR 717

Aspergillus fumigatus RT PCR kit

RTq-VH002-150D Bioingentech 150T
EUR 808

Aspergillus fumigatus RT PCR kit

RTq-VH002-50D Bioingentech 50T
EUR 598

Aspergillus niger RT PCR kit

RTq-A530-100D Bioingentech 100T
EUR 717

Aspergillus niger RT PCR kit

RTq-A530-150D Bioingentech 150T
EUR 808

Aspergillus niger RT PCR kit

RTq-A530-50D Bioingentech 50T
EUR 598

Aspergillus flavus RT PCR kit

RTq-A558-100D Bioingentech 100T
EUR 717

Aspergillus flavus RT PCR kit

RTq-A558-150D Bioingentech 150T
EUR 808

Aspergillus flavus RT PCR kit

RTq-A558-50D Bioingentech 50T
EUR 598

Aspergillus parasticus RT PCR kit

RTq-A559-100D Bioingentech 100T
EUR 717

Aspergillus parasticus RT PCR kit

RTq-A559-150D Bioingentech 150T
EUR 808

Aspergillus parasticus RT PCR kit

RTq-A559-50D Bioingentech 50T
EUR 598

Aspergillus niger 3-phytase A (phyA)

1-CSB-YP333934DOZ Cusabio
  • EUR 679.00
  • EUR 335.00
  • EUR 2172.00
  • EUR 1051.00
  • EUR 1442.00
  • EUR 435.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus niger 3-phytase A(phyA) expressed in Yeast

Aspergillus niger 3-phytase A (phyA)

1-CSB-EP333934DOZ Cusabio
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus niger 3-phytase A(phyA) expressed in E.coli

Aspergillus niger 3-phytase A (phyA)

1-CSB-EP333934DOZa0 Cusabio
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus niger 3-phytase A(phyA) expressed in E.coli

Aspergillus giganteus Ribonuclease alpha-sarcin (sar)

1-CSB-EP365461APN(A5) Cusabio
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Aspergillus giganteus Ribonuclease alpha-sarcin(sar) expressed in E.coli

Guinea pig Aspergillus galactomannan ELISA kit

E05A0108-192T BlueGene 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Guinea pig Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Aspergillus galactomannan ELISA kit

E05A0108-48 BlueGene 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Guinea pig Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Aspergillus galactomannan ELISA kit

E05A0108-96 BlueGene 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Guinea pig Aspergillus galactomannan in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Aspergillus flavus One-Step PCR kit

Oneq-A558-100D Bioingentech 100T
EUR 866

Aspergillus flavus One-Step PCR kit

Oneq-A558-150D Bioingentech 150T
EUR 981

Aspergillus flavus One-Step PCR kit

Oneq-A558-50D Bioingentech 50T
EUR 718

Aspergillus parasticus One-Step PCR kit

Oneq-A559-100D Bioingentech 100T
EUR 866

Aspergillus parasticus One-Step PCR kit

Oneq-A559-150D Bioingentech 150T
EUR 981

Aspergillus parasticus One-Step PCR kit

Oneq-A559-50D Bioingentech 50T
EUR 718

Aspergillus fumigatus One-Step PCR kit

Oneq-VH002-100D Bioingentech 100T
EUR 866

Aspergillus fumigatus One-Step PCR kit

Oneq-VH002-150D Bioingentech 150T
EUR 981

Aspergillus fumigatus One-Step PCR kit

Oneq-VH002-50D Bioingentech 50T
EUR 718
Moreover, technological advances in noninvasive genomic strategies have made it doable to amass genome-scale knowledge from noninvasive biomaterials. Right here, we overview current advances within the evaluation of primate range, with a concentrate on genomic knowledge units throughout the radiation.
dnadna ancestrydna blockdna btsdna geneticsdna hr blockdna hrblock logindna lyricsdna motoringdna painterdna productionsdna replicationdna songdna study slaverydna template sequencedna template slippagedna template stranddna template strand and non-template stranddna template strand and rna stranddna template strand coding stranddna template strand definitiondna template strand meaningdna template strand mrnadna template strand read in what directiondna template strand role in transcriptiondna template strand sequencingdna template strand to amino acid translationdna template strand transcriptiondna template strand translationexosomes 5gexosomes and chfexosomes and coronavirusexosomes and edexosomes and msexosomes and raexosomes and virusesexosomes are virusexosomes dr kaufmanexosomes for deliveryexosomes for hairexosomes for hair lossexosomes mscexosomes njexosomes temexosomes therapyexosomes treatmentgels igagels iga st henry ohiogels kitchengelsemiumgelsemium homeopathicgelsemium sempervirensgelsenkirchengelsey kirklandgelsey kirkland 2020gelsolingelson’s instacartgelson’s market

Post navigation

Comparative Genomics Reveals Novel Target Genes towards Specific Control of Plant-Parasitic Nematodes
Comparison of Growth Characteristics and Genomics of Two Canine Distemper Virus Strains Isolated From Minks in China

Categories

  • Antibodies
  • Assay Kits
  • Biology Cells
  • Blog
  • cDNA
  • Clia Kits
  • colorless
  • Containing
  • Culture Cells
  • Default
  • Devices
  • DNA
  • DNA Templates
  • DNA Testing
  • Elisa Kits
  • Enzymes
  • Equipments
  • Exosomes
  • Gels
  • Goat
  • Green
  • Guinea
  • Hamster
  • Horse serum
  • host
  • hotstart
  • Isotypes
  • Medium & Serums
  • NATtrol
  • Panel
  • Particles
  • PCR
  • Pcr Kits
  • Peptides
  • Reagents
  • Recombinant Proteins
  • Ria Kits
  • RNA
  • TEMED
  • Test Kits
  • Vector & Virus
  • Western Blot

Recent Posts

  • Macaca mulatta Recombinants
  • Sus scrofa Recombinants
  • Helicobacter pylori Recombinants
  • FLUXERGY Reaction Mix COVID-19
  • BRCAaccuTest Plus

Tags

antibodies covid antibodies covid 19 antibodies decline antibodies definition antibodies fade antibodies fading biology cells notes biology cells parts biology cells pdf biology cells practice test biology cells questions biology cells quiz biology cells quiz 3 biology cells quizlet biology cells review biology cells revision flashcards gcse biology cells revision notes gcse biology cells study biology cells study guide biology cells test biology cells unit biology cells unit test biology cells unit test answers biology cells worksheet biology cells worksheets answers biology cells worksheets pdf cannabis assay kits creatinine assay kits enzymes are quizlet enzymes definition enzymes for adhesions enzymes for cats enzymes for digestion enzymes for digestion of lipids enzymes for dogs enzymes for dogs joints enzymes for drain enzymes for drain pipes enzymes for fat enzymes for gluten enzymes for heart gelson’s rancho mirage gelson’s thousand oaks mineral assay kits msd assay kits
Copyright © All rights reserved.Theme MagPress by Sensational Theme